PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7KG109200.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 523aa    MW: 58424.2 Da    PI: 6.2462
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7KG109200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-1972124456
                          -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            +ft+eq+  Le+l++++++p+ ++r++LA+++gL+ rq+k+WFqNrR k k
  Pavir.7KG109200.2.p  72 GKRFTAEQILGLESLYQRCPHPDDSTRKDLAARIGLDARQIKFWFQNRRNKVK 124
                          568***********************************************987 PP

2START97.32.9e-312284513205
                          HHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS.........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
                START   3 aeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv........dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                           e+a++e+v +a+ +ep+W      +++n  e+     +  +        + +e  + +++v +++ +lv  l d+  +W+++++     
  Pavir.7KG109200.2.p 228 TERALYEFVMLASKGEPMWLPATngKILNDLEYKDHTFP--GllgpcpqgFVMEGTKGTTLVRGNAFDLVGLLSDVT-RWSKMFPgiiqG 314
                          578999999999999999999995544444444444433..14578877789999999************9999999.*******99954 PP

                          EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEEC CS
                START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepks 158
                          +   + +s g      g +q m+ +l +  p +p R   f+R++++ +  +w++vdvS d  +  +      +++ ++llpSg+l++++s
  Pavir.7KG109200.2.p 315 VRASNIVSGGsftsldGLIQKMNVDLWVQAPRAPnRSLKFLRFSKRIENNQWAVVDVSMDGIRGIEPdgrRIGYMSCRLLPSGCLLQDMS 404
                          4444445555999***********************************************988776667889****************** PP

                          TCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                START 159 nghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                          ng +kvtw+ h+++++++++ l+r++ +sg+a ga++w+a lqr ce
  Pavir.7KG109200.2.p 405 NGLCKVTWIVHAEYDEASVPPLFRQFFQSGTALGASRWLASLQRRCE 451
                          ********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.8E-2053124IPR009057Homeodomain-like
SuperFamilySSF466891.04E-1757124IPR009057Homeodomain-like
PROSITE profilePS5007116.8666126IPR001356Homeobox domain
SMARTSM003891.2E-1868130IPR001356Homeobox domain
CDDcd000863.11E-1769124No hitNo description
PfamPF000465.1E-1770124IPR001356Homeobox domain
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
PROSITE profilePS5084831.023217455IPR002913START domain
SuperFamilySSF559612.91E-18223451No hitNo description
CDDcd088756.33E-74224451No hitNo description
SMARTSM002349.9E-14226452IPR002913START domain
PfamPF018521.7E-24229451IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MENNWPLNNN DGQGNNSLNP GNETGHLNWL NSLEEYDMDA LMGADDHVNN DQDEDDEEHN  60
LQGAESSSKR SGKRFTAEQI LGLESLYQRC PHPDDSTRKD LAARIGLDAR QIKFWFQNRR  120
NKVKVKAVGD ENKGIQQENA QLQVENMELQ QKLLCGSCRD PNEKWHLLNE NAKLKDTKRR  180
AQDYLIKLIH VTKVPHSETL EHLESAALNL VPFTDDCSTD QDTLVSYTER ALYEFVMLAS  240
KGEPMWLPAT NGKILNDLEY KDHTFPGLLG PCPQGFVMEG TKGTTLVRGN AFDLVGLLSD  300
VTRWSKMFPG IIQGVRASNI VSGGSFTSLD GLIQKMNVDL WVQAPRAPNR SLKFLRFSKR  360
IENNQWAVVD VSMDGIRGIE PDGRRIGYMS CRLLPSGCLL QDMSNGLCKV TWIVHAEYDE  420
ASVPPLFRQF FQSGTALGAS RWLASLQRRC EYMAIMHSSH SSGAAMSPLG RNSVLELSQR  480
MMVSFYTAVS KPVAPLDPSN MSTSGVVSVT LVPICLRQLC AW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1173179LKDTKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980253.11e-156PREDICTED: homeobox-leucine zipper protein ROC6-like
RefseqXP_002446115.11e-151hypothetical protein SORBIDRAFT_06g001940
TrEMBLK3YEP10.0K3YEP1_SETIT; Uncharacterized protein
STRINGSi012707m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.13e-79HD-ZIP family protein